PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do021801.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GATA
Protein Properties Length: 555aa    MW: 58134.6 Da    PI: 9.6483
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do021801.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.25.2e-19470504135
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                 Cs+Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  Do021801.1 470 CSHCGVNKTPQWRAGPEGAKTLCNACGVRYKSGRL 504
                 *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.07464500IPR000679Zinc finger, GATA-type
SMARTSM004018.5E-18464518IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.7E-14467527No hitNo description
Gene3DG3DSA:3.30.50.106.1E-15468502IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.69E-14469526No hitNo description
PROSITE patternPS003440470495IPR000679Zinc finger, GATA-type
PfamPF003205.8E-17470504IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MTSAKTPRRS SSRARSPPHL AAPPALGCAP AAAPSPHRAS RRAPAALPDA LDVDVKPDLS  60
TATSDGRVAA KNERGGGGPD GGGGEGRRRA GVTRWRPGGT RWRPGGWRRT NVGMGDRNFF  120
GKNILLLRVE TDESFGSFVQ FQGEREGKMA ALRSSLRPCE AAEEVEAAAP ASWGTADRGA  180
GLFGDGFSVE DLLDLEDLCE VDKDCAELSE AAPASPVVED AKLSTDSHGS SGVSYELVPP  240
PPPPPVIDLP LPDAKLSTDS HGSSGVSYEL VPPPPPPPVI DLPLPAHDAE ELEWVSRIMD  300
DSLAELPPQP KLPAAPVAAA APRRPLERAA SAAAEGPMRS PTMCALSTEV LVPVKARRSK  360
RSRASVWSLS GGAPLSDSTS SSSTTTTSSC SSSASFSPFF FLPGADSPSP FWSAHLLGEL  420
PPRSSKKSKH GKNGGKPKKR GRKPKHHTVP PQFAAGAAAA SAPAPGDRRC SHCGVNKTPQ  480
WRAGPEGAKT LCNACGVRYK SGRLLPEYRP ACSPTFVSSI HSNSHRKVLE MRRKKEGVVL  540
VPGPAPLPLP AVASF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7279875e-77KJ727987.1 Zea mays clone pUT6103 C2C2-GATA transcription factor (GATA11) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953279.11e-145PREDICTED: GATA transcription factor 5-like
TrEMBLK3YSH51e-145K3YSH5_SETIT; Uncharacterized protein
STRINGSi017219m1e-144(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141733108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.22e-38GATA transcription factor 5